Uupue.site valuation and analysis

Robots.txt Information
Robot Path Permission
GoogleBot /
BingBot /
BaiduSpider /
YandexBot /
Meta Tags
Title UUPUE
Description
Keywords
Server Information
WebSite uupue favicon www.uupue.site
Host IP 47.254.52.238
Location Portland, Oregon, United States
Related Websites
Site Rank
More to Explore
valueinvestorindia.com
vanislandsfinest.ca
venusovermanhattan.com
usi.org.uy
vishwakarmaelectricalappliances.com
visiondream11.com
vistothemes.com
veeshop.in
voirfilm.fr
vook-the-book-store.myshopify.com
gardnerdesign.com
garychangdesign.com
Uupue.site Valuation
US$4,408
Last updated: Jul 23, 2020

Uupue.site has global traffic rank of 3,848,151. Uupue.site has an estimated worth of US$ 4,408, based on its estimated Ads revenue. Uupue.site receives approximately 805 unique visitors each day. Its web server is located in Portland, Oregon, United States, with IP address 47.254.52.238. According to SiteAdvisor, uupue.site is safe to visit.

Traffic & Worth Estimates
Purchase/Sale Value US$4,408
Daily Ads Revenue US$2
Monthly Ads Revenue US$72
Yearly Ads Revenue US$881
Daily Unique Visitors 805
Note: All traffic and earnings values are estimates.
Traffic Ranks
Global Rank 3,848,151
Delta (90 Days) 0
Most Popular In Country N/A
Country Rank N/A
DNS Records
Host Type TTL Data
uupue.site A 599 IP: 47.254.52.238
uupue.site MX 599 Priority: 20
Target: mx2.zoho.com.
uupue.site MX 599 Priority: 50
Target: mx3.zoho.com.
uupue.site MX 599 Priority: 10
Target: mx.zoho.com.
uupue.site NS 21599 Target: f1g1ns2.dnspod.net.
uupue.site NS 21599 Target: f1g1ns1.dnspod.net.
uupue.site SOA 599 MNAME: f1g1ns1.dnspod.net.
RNAME: freednsadmin.dnspod.com.
Serial: 1593678375
Refresh: 3600
Retry: 180
Expire: 1209600
Minimum TTL: 180
HTTP Headers
HTTP/1.1 301 Moved Permanently
Content-Type: text/html; charset=utf-8
Location: https://uupue.site/
Strict-Transport-Security: max-age=315360000; includeSubdomains
X-Content-Type-Options: nosniff
X-Download-Options: noopen
X-Xss-Protection: 1; mode=block
Date: Thu, 23 Jul 2020 00:57:03 GMT
Content-Length: 54

HTTP/2 301 
content-type: text/html; charset=utf-8
location: //www.uupue.site/
request-id: a577ba32-e4b8-4a99-8e68-08731a1fffb1
strict-transport-security: max-age=315360000; includeSubdomains
x-aspnet-version: 4.0.30319
x-content-type-options: nosniff
x-download-options: noopen
x-powered-by: ASP.NET
x-xss-protection: 1; mode=block
content-length: 52
date: Thu, 23 Jul 2020 00:57:04 GMT

HTTP/2 200 
access-control-allow-origin: *
content-type: text/html; charset=UTF-8
date: Thu, 23 Jul 2020 00:57:05 GMT
request-id: fa6fce08-ef15-487f-99a7-a60383b8f098
server: nginx
set-cookie: store_locale=en-US; expires=Fri, 23-Jul-2021 00:57:05 GMT; Max-Age=31536000; path=/; HttpOnly
strict-transport-security: max-age=315360000; includeSubdomains
vary: Accept-Encoding
vary: Accept-Encoding
vary: Accept-Encoding
x-aspnet-version: 4.0.30319
x-content-type-options: nosniff
x-download-options: noopen
x-powered-by: ASP.NET
x-xss-protection: 1; mode=block

Uupue.site Whois Information
Domain Name: UUPUE.SITE
Registry Domain ID: D188549429-CNIC
Registrar WHOIS Server: whois.PublicDomainRegistry.com
Registrar URL: https://publicdomainregistry.com
Updated Date: 2020-06-05T03:19:43.0Z
Creation Date: 2020-06-05T03:08:27.0Z
Registry Expiry Date: 2021-06-05T23:59:59.0Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: N/A
Registrant State/Province: Beijing
Registrant Country: CN
Admin Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Tech Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Name Server: F1G1NS2.DNSPOD.NET
Name Server: F1G1NS1.DNSPOD.NET
DNSSEC: unsigned
Billing Email: Please query the RDDS service of the Registrar of Record identified in this output for information on how to contact the Registrant, Admin, or Tech contact of the queried domain name.
Registrar Abuse Contact Email: abuse@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

https://www.centralnic.com/support/rdap <<<

The Whois and RDAP services are provided by CentralNic, and contain
information pertaining to Internet domain names registered by our
our customers. By using this service you are agreeing (1) not to use any
information presented here for any purpose other than determining
ownership of domain names, (2) not to store or reproduce this data in
any way, (3) not to use any high-volume, automated, electronic processes
to obtain data from this service. Abuse of this service is monitored and
actions in contravention of these terms will result in being permanently
blacklisted. All data is (c) CentralNic Ltd (https://www.centralnic.com)

Access to the Whois and RDAP services is rate limited. For more
information, visit https://registrar-console.centralnic.com/pub/whois_guidance.